PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.F00708.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family EIL
Protein Properties Length: 538aa    MW: 58584.5 Da    PI: 6.3016
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.F00708.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3361.12e-110130949347
                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHH CS
            EIN3  49 msraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTt 143
                     m+raQ giLkYMlk +evcna+GfvYgiipekgkpv gas+++raWWkekv+fd+ngpaai+ky+ +n +ls+++s+   +++++hsl++lqD+t
  Pahal.F00708.1   1 MARAQNGILKYMLKLVEVCNARGFVYGIIPEKGKPVGGASENIRAWWKEKVKFDKNGPAAIAKYELENSMLSNAKSS---GTKNQHSLMDLQDAT 92 
                     89**********************************************************************99999...88************* PP

                     HHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT- CS
            EIN3 144 lgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkm 238
                     lgSLLsalmqhc+p+qrr+pl+kgv+pPWWP+G+e+ww +lgl+k  + ppykkphdlkkawk +vL  vikhm+p++++ir+++r+sk+lqdkm
  Pahal.F00708.1  93 LGSLLSALMQHCSPQQRRYPLDKGVPPPWWPSGNEAWWTALGLPKGES-PPYKKPHDLKKAWKAGVLMGVIKHMAPNFDKIRNQVRKSKCLQDKM 186
                     **********************************************99.9********************************************* PP

                     -SHHHHHHHHHHTTTTT-S--XXXXXX..XXXXXXXXXXXXXXXXXXXX..............XXXXXX.XXXXXXXXXX...........XXXX CS
            EIN3 239 sakesfallsvlnqeekecatvsahss..slrkqspkvtlsceqkedve..............gkkeskikhvqavktta...........gfpv 306
                     +akes ++l vl++eek  +  s++       +q p+ t s+e++ d +              +           +++++           +++ 
  Pahal.F00708.1 187 TAKESLIWLGVLQREEKNDTYSSSDEYdvDRLEQPPRSTSSKEDEGDTQpvlqirgpqistrkK-----------KRRRRdessnqvvskeEMTK 270
                     ****************987666666444433448899999999999999999666666665421...........22222333333334324444 PP

                     XXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXX CS
            EIN3 307 vrkrkkkpsesakvsskevsrtcqssqfrgsetelifadkn 347
                      +++k  ps++  + + ev   +q++  + + ++  ++d+n
  Pahal.F00708.1 271 SQQQK-SPSDHPPIAEDEV-EVTQRNDNPPETVSTAISDMN 309
                     44444.5555555555555.556666655567777777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048735.2E-1091202No hitNo description
Gene3DG3DSA:1.10.3180.102.7E-6776206IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.35E-5982203IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MARAQNGILK YMLKLVEVCN ARGFVYGIIP EKGKPVGGAS ENIRAWWKEK VKFDKNGPAA  60
IAKYELENSM LSNAKSSGTK NQHSLMDLQD ATLGSLLSAL MQHCSPQQRR YPLDKGVPPP  120
WWPSGNEAWW TALGLPKGES PPYKKPHDLK KAWKAGVLMG VIKHMAPNFD KIRNQVRKSK  180
CLQDKMTAKE SLIWLGVLQR EEKNDTYSSS DEYDVDRLEQ PPRSTSSKED EGDTQPVLQI  240
RGPQISTRKK KRRRRDESSN QVVSKEEMTK SQQQKSPSDH PPIAEDEVEV TQRNDNPPET  300
VSTAISDMNI FYPMDVVGMA NQPASLNHVP TIGSLQQHAD SQGNFLSPGA AINNCNSNQD  360
ASAALNNNNN SNQAASAALN NYSSNQAARA AQSSTYLSDP PLACEGSDDI VNSWSGHSFL  420
RDIGRGPIGF NPSPVVQPST MQQPLPLPTD HHAPIVGTGA LSEDGTYSYP TAGSGHPGTV  480
ASEARQLMDG SFFGEAADKF AGDSFGALPL SLIPISSPIP FLDVFLDDDE LMPYLGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A1e-59822029129ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1247255RKKKRRRRD
2248253KKKRRR
3248254KKKRRRR
4249254KKRRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973869.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLK3YGQ80.0K3YGQ8_SETIT; Uncharacterized protein
STRINGSi013426m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37203779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-106ETHYLENE-INSENSITIVE3-like 3